PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_20551A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 289aa    MW: 31524.5 Da    PI: 7.2734
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_20551AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171562148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd  lv +++q+G+g+W+++++  g+ R+ k+c++rw +yl
  Oropetium_20150105_20551A 15 KGPWTPEEDIVLVSYIQQHGPGNWRSVPENTGLMRCSKSCRLRWTNYL 62
                               79********************************************97 PP

2Myb_DNA-binding47.44.4e-1568113148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++T+ E+ +++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Oropetium_20150105_20551A  68 RGNFTPHEEGIIIHLQALLGNK-WAAIASYLP-QRTDNDIKNYWNTHL 113
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2471066IPR017930Myb domain
SuperFamilySSF466891.59E-3012109IPR009057Homeodomain-like
SMARTSM007175.7E-131464IPR001005SANT/Myb domain
PfamPF002491.2E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-231669IPR009057Homeodomain-like
CDDcd001677.37E-121762No hitNo description
SMARTSM007172.4E-1367115IPR001005SANT/Myb domain
PROSITE profilePS5129419.14867117IPR017930Myb domain
PfamPF002492.4E-1368113IPR001005SANT/Myb domain
CDDcd001674.92E-1070113No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2470117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRPPCCDNG VGVKKGPWTP EEDIVLVSYI QQHGPGNWRS VPENTGLMRC SKSCRLRWTN  60
YLRPGIKRGN FTPHEEGIII HLQALLGNKW AAIASYLPQR TDNDIKNYWN THLKKKVKRL  120
QTHHQADHSS QAIASNNAVG SPNYYSHGST QQQHSLQAMQ TTMNPNTAYG GAPQSSNEAA  180
AATAVSNLFH TWMRPSPVTT AADYKITMQE YQEDQAAAAT VVCKDQIVFN DDKSSSSSGM  240
MVAPVMMGSS TATFSLLEDW LLDDMPGQAA MDGLMGISGG CCADPIMF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-261511727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0838811e-145BT083881.1 Zea mays full-length cDNA clone ZM_BFb0050H17 mRNA, complete cds.
GenBankEU9555501e-145EU955550.1 Zea mays clone 1536772 mRNA sequence.
GenBankKJ7276111e-145KJ727611.1 Zea mays clone pUT5518 MYB transcription factor (MYB61) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979484.11e-154PREDICTED: transcription factor MYB30-like
TrEMBLK3ZJI01e-154K3ZJI0_SETIT; Uncharacterized protein
STRINGSi026733m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-84myb domain protein 60